Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 8 (SCGR8)

This Recombinant Human Small cysteine and glycine repeat-containing protein 8 (SCGR8) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 8; Keratin-associated protein 28-8; SCYGR8 KRTAP28-8

UniProt

A0A286YFG1

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGGCGGGCGGCSGGCGGGCGGGCGGGGCGGGCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCSSCGCGYGKGCCQQKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ALKBH5 activation kit by CRISPRa
GA110346 1 Kit

Human ALKBH5 activation kit by CRISPRa

Sign In for Pricing
View Details
RIP3 Recombinant Rabbit monoclonal Antibody
HA750973 100 µL

RIP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF568 conjugate, 0.1mg/mL
BNC680500-500 1x 500 µL

Progesterone Receptor (PR500), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Col24a1 activation kit by CRISPRa
GA208807 1 Kit

Mouse Col24a1 activation kit by CRISPRa

Sign In for Pricing
View Details
WNT5B Recombinant Rabbit Monoclonal Antibody [JE53-67]
ET7110-34 100 µL

WNT5B Recombinant Rabbit Monoclonal Antibody [JE53-67]

Sign In for Pricing
View Details
BCECF, AM Ester, 10x100UG
#51011 10x 100 µg

BCECF, AM Ester, 10x100UG

Sign In for Pricing
View Details