Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Heterogeneous nuclear ribonucleoprotein A1-like 3 (RA1L3)

This Recombinant Human Heterogeneous nuclear ribonucleoprotein A1-like 3 (RA1L3) spans the amino acid sequence from region 1-320. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heterogeneous nuclear ribonucleoprotein A1-like 3; Heterogeneous nuclear ribonucleoprotein A1 pseudogene 48; HNRNPA1L3 HNRNPA1P48

UniProt

A0A2R8Y4L2

Expression Region

1-320

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPDAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFEGRSSGPHGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP/PARP1 Picoband Antibody (monoclonal, 10G9)
orb1882248 100 µg

PARP/PARP1 Picoband Antibody (monoclonal, 10G9)

Sign In for Pricing
View Details
Recombinant human Seprase
OPCA00084-1MG 1 mg

Recombinant human Seprase

Sign In for Pricing
View Details
Ac-Arg-pNA · HCl
4004007.1 1 g

Ac-Arg-pNA · HCl

Sign In for Pricing
View Details
WNT3A (Wingless Type MMTV Integration Site Family, Member 3A)
365605 200 µL

WNT3A (Wingless Type MMTV Integration Site Family, Member 3A)

Sign In for Pricing
View Details
VN1R12P Protein Vector (Human) (pPM-C-HA)
49865021 500 ng

VN1R12P Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
5-Methoxyresorcinol
orb1297788-01 1 ml x 10 mM (in DMSO)

5-Methoxyresorcinol

Sign In for Pricing
View Details