Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial

This Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial spans the amino acid sequence from region 1756-1817. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative PWWP domain-containing DNA repair factor 4 PWWP4

UniProt

A0A494C071

Expression Region

1756-1817

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RGTMVWFKFQDHPFWPAVVKSVSNTDKTARVLLLEANLHHGKRGIQVPLRRLKHLDCKEKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Selenoprotein W, Sepw1 ELISA KIT
ELI-39303m 96 Tests

Mouse Selenoprotein W, Sepw1 ELISA KIT

Sign In for Pricing
View Details
Uhmk1 3'UTR Lenti-reporter-Luc Vector
49151086 1.0 µg

Uhmk1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
UBE2S shRNA Plasmid (h)
sc-97109-SH 20 µg

UBE2S shRNA Plasmid (h)

Sign In for Pricing
View Details
FAM13A-set siRNA/shRNA/RNAi Lentivector (Human)
19781091 4x 500 ng

FAM13A-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
MTAP Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62628R-BF594-01 20 µL

MTAP Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
MTAP Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62628R-BF594-02 100 µL

MTAP Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details