Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Taurine up-regulated 1 protein (TUG1), partial

This Recombinant Human Taurine up-regulated 1 protein (TUG1), partial spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Taurine up-regulated 1 protein TUG1

UniProt

A0A6I8PU40

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPPRRAPGGRWRSRRVFLLVRRTRAAAYAFAIRRGVVRVVGGGGQLLRPAPGEAAAAAAAGFGAAGEAGVAGAGLEAWRHPSGPARTQLGGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P40-phox (D-8) Alexa Fluor® 594
sc-48388 AF594 200 µg/mL

P40-phox (D-8) Alexa Fluor® 594

Sign In for Pricing
View Details
4-[ (1H,1H-Heptafluorobutyl) amino]phenol
PC107515 1 Each

4-[ (1H,1H-Heptafluorobutyl) amino]phenol

Sign In for Pricing
View Details
Cytokeratin 75 antibody
70R-3039 100 µL

Cytokeratin 75 antibody

Sign In for Pricing
View Details
Customized Transposable element activator uncharacterized 23 kDa Antibody
orb837847 2 mg

Customized Transposable element activator uncharacterized 23 kDa Antibody

Sign In for Pricing
View Details
GIRK2 (Kir3.2, Kcnj6, G-protein Activated Inwardly Rectifying Potassium Channel) discontinued
G2035-05 200 µL

GIRK2 (Kir3.2, Kcnj6, G-protein Activated Inwardly Rectifying Potassium Channel) discontinued

Sign In for Pricing
View Details
YIPF4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50614066 1.0 µg DNA

YIPF4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details