What sizes are available for Recombinant Human RING finger protein 228 (RN228), partial?

Recombinant Human RING finger protein 228 (RN228), partial is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human RING finger protein 228 (RN228), partial come in?

Recombinant Human RING finger protein 228 (RN228), partial is available in 3 different pack sizes.

Recombinant Human RING finger protein 228 (RN228), partial

Q: What is the catalog number for Recombinant Human RING finger protein 228 (RN228), partial?

The catalog number for Recombinant Human RING finger protein 228 (RN228), partial is orb3006770.

This Recombinant Human RING finger protein 228 (RN228), partial spans the amino acid sequence from region 1-235. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RING finger protein 228 RNF228

UniProt

A0A7I2V3R4

Expression Region

1-235

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAPASDSGGSQQSPSSSPGSREGAGVAAKGAPDCGDAGARDAAETVSGLPPLEDYECKICYNYFDADRRAPKLLACLHTFCQECLSQLQLRAAAAAAAAAAPERPPRPPPWLCPPGAIACPVCRHRTPLPDSRVHGLPNNTKLAEAFPLALRAAHDPLPQDRLPPLPARLPAPAAAPPPTPAPPPPPSPAPPQPPPPPPAEDAAPGPRARPGLRAPGAYDSCQNCKRAALTAGC