Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142)

This Recombinant Human Uncharacterized protein encoded by LINC02881 (CJ142) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC02881; Long intergenic non-protein coding RNA 2881; LINC02881 C10orf142

UniProt

B7Z368

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSCKRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRVAGGGGAPGGGAGMRCCGCRERNINKELELF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bag-1 shRNA Plasmid (r)
sc-61877-SH 20 µg

Bag-1 shRNA Plasmid (r)

Sign In for Pricing
View Details
Cyp4f18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV683493 1.0 µg DNA

Cyp4f18 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
GRK5 Colorimetric Cell-Based ELISA
EKC1709 1 Kit, containing one 96 Well Plate and all necessary reagents

GRK5 Colorimetric Cell-Based ELISA

Sign In for Pricing
View Details
Caspase-4/5 p20, cleaved (D270/D311) discontinued
340265-01 100 µL

Caspase-4/5 p20, cleaved (D270/D311) discontinued

Sign In for Pricing
View Details
Caspase-4/5 p20, cleaved (D270/D311) discontinued
340265-02 200 µL

Caspase-4/5 p20, cleaved (D270/D311) discontinued

Sign In for Pricing
View Details
FTLL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0819808 1.0 µg DNA

FTLL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details