Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UBAP1-MVB12-associated (UMAD1)

This Recombinant Human UBAP1-MVB12-associated (UMAD1) spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS

UniProt

C9J7I0

Expression Region

1-137

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Acetamidonicotinic acid
RG-E140828-01 10 mg

6-Acetamidonicotinic acid

Sign In for Pricing
View Details
6-Acetamidonicotinic acid
RG-E140828-02 25 mg

6-Acetamidonicotinic acid

Sign In for Pricing
View Details
6-Acetamidonicotinic acid
RG-E140828-03 50 mg

6-Acetamidonicotinic acid

Sign In for Pricing
View Details
6-Acetamidonicotinic acid
RG-E140828-04 100 mg

6-Acetamidonicotinic acid

Sign In for Pricing
View Details
Il15ra 3'UTR GFP Stable Cell Line
TU160019 1.0 mL

Il15ra 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Beta Catenin (5D6) Mouse Monoclonal Antibody, 1 pack = 20 µL
BAL4679 1 Each

Beta Catenin (5D6) Mouse Monoclonal Antibody, 1 pack = 20 µL

Sign In for Pricing
View Details