Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial

This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B4 NPIPB4

UniProt

C9JG80

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Oxo-2H,3H,5H,9bh-[1,3]thiazolo[2,3-a]isoindole-3-carboxylic acid
TEA72668-01 50 mg

5-Oxo-2H,3H,5H,9bh-[1,3]thiazolo[2,3-a]isoindole-3-carboxylic acid

Sign In for Pricing
View Details
5-Oxo-2H,3H,5H,9bh-[1,3]thiazolo[2,3-a]isoindole-3-carboxylic acid
TEA72668-02 0.5 g

5-Oxo-2H,3H,5H,9bh-[1,3]thiazolo[2,3-a]isoindole-3-carboxylic acid

Sign In for Pricing
View Details
3-Hydroxy-2-methylpyridine
orb1301402-01 1 ml x 10 mM (in DMSO)

3-Hydroxy-2-methylpyridine

Sign In for Pricing
View Details
3-Hydroxy-2-methylpyridine
orb1301402-02 100 mg

3-Hydroxy-2-methylpyridine

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-human CD199 (CCR9)
GT14039 25 Tests

Alexa Fluor® 647 anti-human CD199 (CCR9)

Sign In for Pricing
View Details
MELK-IN-1 10mg
A12675-10 10 mg

MELK-IN-1 10mg

Sign In for Pricing
View Details