Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2)

This Recombinant Human Protein PRAC2 (PRAC2) spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Interleukin-6 IL6 Antibody Picoband® (Dylight488 Conjugate)
PA1352-Dylight488 100 µg

Anti-Interleukin-6 IL6 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Mpzl2 (NM_001106818) Rat Untagged Clone
RN209988 10 µg

Mpzl2 (NM_001106818) Rat Untagged Clone

Sign In for Pricing
View Details
ARL8B Polyclonal Antibody
A71908-100 100 µL

ARL8B Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae arsC Protein (aa 1-102)
VAng-Wyb2068-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae arsC Protein (aa 1-102)

Sign In for Pricing
View Details
Hydroxy-PEG3-acid
orb1705374-01 50 mg

Hydroxy-PEG3-acid

Sign In for Pricing
View Details
Hydroxy-PEG3-acid
orb1705374-02 100 mg

Hydroxy-PEG3-acid

Sign In for Pricing
View Details