Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2)

This Recombinant Human Protein PRAC2 (PRAC2) spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prion-Like protein doppel (PRND) Sheep ELISA Kit
G0850 96 Tests

Prion-Like protein doppel (PRND) Sheep ELISA Kit

Sign In for Pricing
View Details
Ick ORF Vector (Mouse) (pORF)
24152015 1.0 µg DNA

Ick ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ELISA Kit FOR SH3 domain-binding protein 1
E6111h 96 Tests

ELISA Kit FOR SH3 domain-binding protein 1

Sign In for Pricing
View Details
TUBA6 (TUBA1C) (NM_032704) Human Over-expression Lysate
E45H12924-2 20 µg

TUBA6 (TUBA1C) (NM_032704) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human DGKA Protein, N-His
orb3059040-01 50 µg

Recombinant Human DGKA Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DGKA Protein, N-His
orb3059040-02 100 µg

Recombinant Human DGKA Protein, N-His

Sign In for Pricing
View Details