Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2)

This Recombinant Human Protein PRAC2 (PRAC2) spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal CD97 Antibody (2Q42) [Allophycocyanin]
NBP2-22000APC 0.1 mL

Rat Monoclonal CD97 Antibody (2Q42) [Allophycocyanin]

Sign In for Pricing
View Details
Lentiviral human CAPN9 shRNA (UAS) - Lentiviral human CAPN9 shRNA (UAS, GFP) plasmid
GTR15079330 1 Vial

Lentiviral human CAPN9 shRNA (UAS) - Lentiviral human CAPN9 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CPNE1 Recombinant Protein (Human)
RP007876 100 µg

CPNE1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Sheep β2 Glycoprotein 1 antibody IgM ELISA kit
GTR10380945 96 Well

Sheep β2 Glycoprotein 1 antibody IgM ELISA kit

Sign In for Pricing
View Details
Olfr399 Protein Lysate (Mouse) with C-HA Tag
33128034 100 µg

Olfr399 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa murA Protein (aa 1-421)
VAng-Cr0560-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa murA Protein (aa 1-421)

Sign In for Pricing
View Details