Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative serine protease 46 (PRS46)

This Recombinant Human Putative serine protease 46 (PRS46) spans the amino acid sequence from region 1-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative serine protease 46; EC 3.4.21.-; Serine protease 46 pseudogene; PRSS46P PRSS46

UniProt

E5RG02

Expression Region

1-174

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit
MBS7257177-01 48 Well

Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit

Sign In for Pricing
View Details
Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit
MBS7257177-02 96 Well

Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit

Sign In for Pricing
View Details
Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit
MBS7257177-03 5x 96 Well

Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit

Sign In for Pricing
View Details
Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit
MBS7257177-04 10x 96 Well

Rabbit 26S Proteasome Non ATPase Regulatory Subunit 12 (PSMD12) ELISA Kit

Sign In for Pricing
View Details
FTHP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
57711151 3x 1.0 µg DNA

FTHP2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
LentimiRa-hsa-miR-18b-3p Vector
mh41642 500 ng

LentimiRa-hsa-miR-18b-3p Vector

Sign In for Pricing
View Details