Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative serine protease 46 (PRS46)

This Recombinant Human Putative serine protease 46 (PRS46) spans the amino acid sequence from region 1-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative serine protease 46; EC 3.4.21.-; Serine protease 46 pseudogene; PRSS46P PRSS46

UniProt

E5RG02

Expression Region

1-174

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1559980 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6220003 1.0 µg DNA

RGD1559980 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human anti-human tetraiodothyronine (T4) mAb (T67)
A09K07-T67 1 Each

Human anti-human tetraiodothyronine (T4) mAb (T67)

Sign In for Pricing
View Details
MEF2A, GST-Tag, Recombinant (ADCAD1, RSRFC4, RSRFC9, Mef2, Myocyte-Specific Enhancer Factor 2A) discontinued
500820 200 µg

MEF2A, GST-Tag, Recombinant (ADCAD1, RSRFC4, RSRFC9, Mef2, Myocyte-Specific Enhancer Factor 2A) discontinued

Sign In for Pricing
View Details
OSM Recombinant Protein
OPCD05924-50UG 50 µg

OSM Recombinant Protein

Sign In for Pricing
View Details
Anti-AIDA Antibody Picoband®, PE Conjugate
A04989-1-PE 100 µg/Vial

Anti-AIDA Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Bone Sialoprotein, Human, aa262-279 (Bone Sialoprotein 2, BSP2, Cell-Binding Sialoprotein, Integrin-Binding Sialoprotein)
298127-01 100 µg

Bone Sialoprotein, Human, aa262-279 (Bone Sialoprotein 2, BSP2, Cell-Binding Sialoprotein, Integrin-Binding Sialoprotein)

Sign In for Pricing
View Details