Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079)

This Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079) spans the amino acid sequence from region 1-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC01619 LINC01619 C12orf79

UniProt

G3V211

Expression Region

1-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

METTL9 Human Gene Knockout Kit (CRISPR)
KN400028 1 Kit

METTL9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC-conjugated Myc-Tag Monoclonal Antibody
AN00300C-01 25 µL

FITC-conjugated Myc-Tag Monoclonal Antibody

Sign In for Pricing
View Details
FITC-conjugated Myc-Tag Monoclonal Antibody
AN00300C-02 100 µL

FITC-conjugated Myc-Tag Monoclonal Antibody

Sign In for Pricing
View Details
FER Rabbit Polyclonal Antibody
AP06672PU-N 100 µg

FER Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Btn1a1 activation kit by CRISPRa
GA200451 1 Kit

Mouse Btn1a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Glyphosate-C3-d2
TRC-G764998-25MG 25 mg

Glyphosate-C3-d2

Sign In for Pricing
View Details