Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)
This Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3; Rhodanese domain-containing protein 3; TSTD3
UniProt
H0UI37
Expression Region
1-97
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C7850-82B-ML490 100 µL
Complement Factor H (CFH, H Factor 1, HF, HF1, HF2, beta1 H-globulin, b1H Globulin) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
