Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM72C (FA72C)

This Recombinant Human Protein FAM72C (FA72C) spans the amino acid sequence from region 1-149. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM72C FAM72C

UniProt

H0Y354

Expression Region

1-149

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVVYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVLNISAEECIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3-Dihydro-5-mercapto-3-oxo-4-isothiazolecarboxylic Acid Trisodium Salt
TRC-D452920-1G 1 g

2,3-Dihydro-5-mercapto-3-oxo-4-isothiazolecarboxylic Acid Trisodium Salt

Sign In for Pricing
View Details
N-Jasmonyl-L-Isoleucine (Mixture of Diastereomers)
TRC-J210550-10MG 10 mg

N-Jasmonyl-L-Isoleucine (Mixture of Diastereomers)

Sign In for Pricing
View Details
Ranimustine
TRC-R120030-25MG 25 mg

Ranimustine

Sign In for Pricing
View Details
TMEM151B (NM_001137560) Human Over-expression Lysate
LY427940 100 µg

TMEM151B (NM_001137560) Human Over-expression Lysate

Sign In for Pricing
View Details
Clathrin light chain (CLTA) (NM_007096) Human Recombinant Protein
TP319035M 100 µg

Clathrin light chain (CLTA) (NM_007096) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Frizzled 9 Antibody
RC-15906-01 50 μL

Recombinant Frizzled 9 Antibody

Sign In for Pricing
View Details