Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6L (LY6L)

This Recombinant Human Lymphocyte antigen 6L (LY6L) spans the amino acid sequence from region 17-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6L; Lymphocyte antigen 6 complex locus protein L; LY6L

UniProt

H3BQJ8

Expression Region

17-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAGCATTPARNLSCYQCFKVSSWTECPPTWCSPLDQVCISNEVVVSFKWSVRVLLSKRCAPRCPNDNMKFEWSPAPMVQGVITRRCCSWALCNRALTPQEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Osteoprotegerin (OPG)
TRV-0001408-01 10 µg

Active Osteoprotegerin (OPG)

Sign In for Pricing
View Details
Active Osteoprotegerin (OPG)
TRV-0001408-02 50 µg

Active Osteoprotegerin (OPG)

Sign In for Pricing
View Details
Active Osteoprotegerin (OPG)
TRV-0001408-03 100 µg

Active Osteoprotegerin (OPG)

Sign In for Pricing
View Details
Active Osteoprotegerin (OPG)
TRV-0001408-04 200 µg

Active Osteoprotegerin (OPG)

Sign In for Pricing
View Details
Active Osteoprotegerin (OPG)
TRV-0001408-05 500 µg

Active Osteoprotegerin (OPG)

Sign In for Pricing
View Details
Active Osteoprotegerin (OPG)
TRV-0001408-06 1 mg

Active Osteoprotegerin (OPG)

Sign In for Pricing
View Details