Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small leucine-rich protein 1 (SMLR1), partial

This Recombinant Human Small leucine-rich protein 1 (SMLR1), partial spans the amino acid sequence from region 74-107. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small leucine-rich protein 1 SMLR1

UniProt

H3BR10

Expression Region

74-107

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF740 conjugate, 0.1mg/mL
BNC741620-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (2D2), CF568 conjugate, 0.1mg/mL
BNC680004-100 1x 100 µL

Bax (2D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL
BNC472711-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL
BNC880820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details