Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178B (T178B), partial

This Recombinant Human Transmembrane protein 178B (T178B), partial spans the amino acid sequence from region 24-171. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 178B TMEM178B

UniProt

H3BS89

Expression Region

24-171

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Amino-2-(4-chlorophenylazo)naphthalene-5-sulfonamide
A603503 100 mg

1-Amino-2-(4-chlorophenylazo)naphthalene-5-sulfonamide

Sign In for Pricing
View Details
Cadherin 16 (CDH16) (NM_004062) Human Mass Spec Standard
PH306551 10 µg

Cadherin 16 (CDH16) (NM_004062) Human Mass Spec Standard

Sign In for Pricing
View Details
MIR4644 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV769624 1.0 µg DNA

MIR4644 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)
MBS2128620-01 0.1 mL

APC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)
MBS2128620-02 0.2 mL

APC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details
APC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)
MBS2128620-03 0.5 mL

APC Linked Monoclonal Antibody to Vascular Endothelial Growth Factor A (VEGFA)

Sign In for Pricing
View Details