Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178B (T178B), partial

This Recombinant Human Transmembrane protein 178B (T178B), partial spans the amino acid sequence from region 24-171. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 178B TMEM178B

UniProt

H3BS89

Expression Region

24-171

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claudin 6 (CLDN6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]
TA506894BM 100 µL

Claudin 6 (CLDN6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details
PCR 8/4 Strips
SL-PCR8-0.2-W-SFC 125 Strips/Bag, 10 Bags/CTN

PCR 8/4 Strips

Sign In for Pricing
View Details
Lentiviral human SRP9 sgRNA gene knockout kit - Lentiviral human SRP9 sgRNA gene knockout kit (100)
GTR15401278 1 Vial

Lentiviral human SRP9 sgRNA gene knockout kit - Lentiviral human SRP9 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
BCLAF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
13249066 1.0 µg DNA

BCLAF1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RPIA (Ribose-5-phosphate Isomerase, RPI, Phosphoriboisomerase) (MaxLight 405) discontinued
132765-ML405 100 µL

RPIA (Ribose-5-phosphate Isomerase, RPI, Phosphoriboisomerase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
FCN2 (Ficolin-2, 37kD Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL) (Biotin)
126727-Biotin 100 µL

FCN2 (Ficolin-2, 37kD Elastin-binding Protein, Collagen/Fibrinogen Domain-containing Protein 2, EBP-37, Ficolin-B, Ficolin-beta, Hucolin, L-ficolin, Serum Lectin p35, FCNL) (Biotin)

Sign In for Pricing
View Details