Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial

This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB3 Polyclonal Antibody
bs-6823R 100 µL

MAGEB3 Polyclonal Antibody

Sign In for Pricing
View Details
FUBP3, NT (Far Upstream Element-binding Protein 3, FUSE-binding Protein 3, FBP3) (MaxLight 490) discontinued
F2960-53A-ML490 100 µL

FUBP3, NT (Far Upstream Element-binding Protein 3, FUSE-binding Protein 3, FBP3) (MaxLight 490) discontinued

Sign In for Pricing
View Details
6-Chloro-tetral-1-on
sc-476971 100 mg

6-Chloro-tetral-1-on

Sign In for Pricing
View Details
BRSK1 Antibody, HRP conjugated
A62958-100UG 100 µg

BRSK1 Antibody, HRP conjugated

Sign In for Pricing
View Details
OR2T32P AAV Vector (Human) (CMV)
35113101 1 µg

OR2T32P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Palonidipine 10mg
A19510-10 10 mg

Palonidipine 10mg

Sign In for Pricing
View Details