Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rb (RB1) Rabbit Polyclonal Antibody
TA380743 100 µL

Rb (RB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MRPS36 activation kit by CRISPRa
GA114195 1 Kit

Human MRPS36 activation kit by CRISPRa

Sign In for Pricing
View Details
KSR2 Human Gene Knockout Kit (CRISPR)
KN211665 1 Kit

KSR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PEX5 related protein (PEX5L) Human Gene Knockout Kit (CRISPR)
KN419522 1 Kit

PEX5 related protein (PEX5L) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
O-Acetyl Mandelic Acid
TRC-A185963-250MG 250 mg

O-Acetyl Mandelic Acid

Sign In for Pricing
View Details
CKAP1 (TBCB) (NM_001281) Human Over-expression Lysate
LC420030 20 µg

CKAP1 (TBCB) (NM_001281) Human Over-expression Lysate

Sign In for Pricing
View Details