Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4,6-Tri-tert-butylphenol (Standard)
HY-W013050R 1 Each

2,4,6-Tri-tert-butylphenol (Standard)

Sign In for Pricing
View Details
MultiSUB MIDI96 Stretch Comb Block, 24 x 8 sample multichannel wells + 1 Marker, 1mm thick
MSMIDI96STDBL-8-1-CB 1 Each

MultiSUB MIDI96 Stretch Comb Block, 24 x 8 sample multichannel wells + 1 Marker, 1mm thick

Sign In for Pricing
View Details
GOT1L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22417154 3x 1.0 µg DNA

GOT1L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Genorise® Sheep IL-10 polyclonal antibody
GR105094 100 µg

Genorise® Sheep IL-10 polyclonal antibody

Sign In for Pricing
View Details
Human Colon Cancer specific antigene 3 ELISA Kit
MBS724774-01 48 Well

Human Colon Cancer specific antigene 3 ELISA Kit

Sign In for Pricing
View Details
Human Colon Cancer specific antigene 3 ELISA Kit
MBS724774-02 96 Well

Human Colon Cancer specific antigene 3 ELISA Kit

Sign In for Pricing
View Details