Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF405S conjugate, 0.1mg/mL
BNC041372-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chloramphenicol
TRC-C325030-1G 1 g

Chloramphenicol

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB508266 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
6-Bromo-2-napthoic Acid
TRC-B685930-5G 5 g

6-Bromo-2-napthoic Acid

Sign In for Pricing
View Details
Rat IgG (H+L), AlpSdAbs® VHH
HA710282 100 µg

Rat IgG (H+L), AlpSdAbs® VHH

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC709), CF647 conjugate, 0.1mg/mL
BNC470709-100 1x 100 µL

Human Kappa Light Chain (KLC709), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details