Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN2 Protein Vector (Mouse) (pPB-N-His)
PV242387 500 ng

TSPAN2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human TMEM70 activation kit by CRISPRa
GA110413 1 Kit

Human TMEM70 activation kit by CRISPRa

Sign In for Pricing
View Details
Human RAP2A Protein Lysate
MBS8418296-01 0.02 mg

Human RAP2A Protein Lysate

Sign In for Pricing
View Details
Human RAP2A Protein Lysate
MBS8418296-02 5x 0.02 mg

Human RAP2A Protein Lysate

Sign In for Pricing
View Details
Goat polyclonal antibody for Influenza A
1314 1 ml

Goat polyclonal antibody for Influenza A

Sign In for Pricing
View Details
FBA3 Antibody
orb784198 2 mg

FBA3 Antibody

Sign In for Pricing
View Details