Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082)

This Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082) spans the amino acid sequence from region 1-104. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein ZNF561-AS1; ZNF561 antisense RNA 1; ZNF561 antisense gene protein 1; ZNF561-AS1 C19orf82

UniProt

K7EIQ3

Expression Region

1-104

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRIPGGCSSKAFIGRAQWLTPVIPALWEAKGLTLLSRLECSDVIMDHCSPQLTGLRMKGFLAQTPPLEFPVHQYQPGDHVLIKSWKRESLNQLRRTSSGTLDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGCR Conjugated Antibody
MBS9456983-01 0.1 mL (Biotin)

HMGCR Conjugated Antibody

Sign In for Pricing
View Details
HMGCR Conjugated Antibody
MBS9456983-02 0.1 mL (AF350)

HMGCR Conjugated Antibody

Sign In for Pricing
View Details
HMGCR Conjugated Antibody
MBS9456983-03 0.1 mL (AF405)

HMGCR Conjugated Antibody

Sign In for Pricing
View Details
HMGCR Conjugated Antibody
MBS9456983-04 0.1 mL (AF488)

HMGCR Conjugated Antibody

Sign In for Pricing
View Details
HMGCR Conjugated Antibody
MBS9456983-05 0.1 mL (AF555)

HMGCR Conjugated Antibody

Sign In for Pricing
View Details
HMGCR Conjugated Antibody
MBS9456983-06 0.1 mL (AF594)

HMGCR Conjugated Antibody

Sign In for Pricing
View Details