Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082)

This Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082) spans the amino acid sequence from region 1-104. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein ZNF561-AS1; ZNF561 antisense RNA 1; ZNF561 antisense gene protein 1; ZNF561-AS1 C19orf82

UniProt

K7EIQ3

Expression Region

1-104

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRIPGGCSSKAFIGRAQWLTPVIPALWEAKGLTLLSRLECSDVIMDHCSPQLTGLRMKGFLAQTPPLEFPVHQYQPGDHVLIKSWKRESLNQLRRTSSGTLDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-U6-FOXO3-shRNA2-CopGFP-Puro Plasmid
PVT48322 2 µg

pLV3-U6-FOXO3-shRNA2-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Profilin-1 shRNA Plasmid (m)
sc-36317-SH 20 µg

Profilin-1 shRNA Plasmid (m)

Sign In for Pricing
View Details
Canine mitochondrial respiratory chain complex I ELISA Kit
GTR10368499 96 Well

Canine mitochondrial respiratory chain complex I ELISA Kit

Sign In for Pricing
View Details
OR52Z1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1570802 1.0 µg DNA

OR52Z1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Scnn1a 3'UTR Luciferase Stable Cell Line
TU118430 1.0 mL

Scnn1a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ALG1L8P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene)
475108 100 µL

ALG1L8P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene)

Sign In for Pricing
View Details