Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 17 (SIM17), partial

This Recombinant Human Small integral membrane protein 17 (SIM17), partial spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 17 SMIM17

UniProt

P0DL12

Expression Region

1-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASSHDSDEKDLSSQETGLSQEWSSVEEDDESEGSQGFVEWSKAPQQTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBJ (DNAJC27) (N-term) Rabbit Polyclonal Antibody
AP51295PU-N 400 µL

RBJ (DNAJC27) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Apolipoprotein E Recombinant Rabbit monoclonal Antibody
HA725222B 100 µL

Mouse Apolipoprotein E Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AzoDye-1 PEG10 Alkyne
2415-AAT 1 mg

AzoDye-1 PEG10 Alkyne

Sign In for Pricing
View Details
2,2-Dichloroacetic Acid-1-13C
TRC-D431828-1MG 1 mg

2,2-Dichloroacetic Acid-1-13C

Sign In for Pricing
View Details
Human IgA Immunoglobulin (IA761), CF594 conjugate, 0.1mg/mL
BNC940761-100 1x 100 µL

Human IgA Immunoglobulin (IA761), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dll3 Mouse Gene Knockout Kit (CRISPR)
KN304621BN 1 Kit

Dll3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details