Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 23D2 (P23D2)

This Recombinant Human Proline-rich protein 23D2 (P23D2) spans the amino acid sequence from region 1-279. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proline-rich protein 23D2 PRR23D2

UniProt

P0DMB1

Expression Region

1-279

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Creb3 Rat shRNA Plasmid (Locus ID 298400)
TR701842 1 Kit

Creb3 Rat shRNA Plasmid (Locus ID 298400)

Sign In for Pricing
View Details
Glycine, EP, USP grade
GM2320-500g 500 g

Glycine, EP, USP grade

Sign In for Pricing
View Details
Epiregulin Double Nickase Plasmid (m2)
sc-420224-NIC-2 20 µg

Epiregulin Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
KISS1, CT
501918 200 µL

KISS1, CT

Sign In for Pricing
View Details
CMAH (E-7) Alexa Fluor® 488
sc-365023 AF488 200 µg/mL

CMAH (E-7) Alexa Fluor® 488

Sign In for Pricing
View Details
Usp20 Mouse Pre-designed siRNA Set A
HY-RS16871 1 Set

Usp20 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details