Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial

This Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial spans the amino acid sequence from region 57-153. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative transmembrane protein INAFM2; InaF-motif-containing protein 2; Osteogenesis up-regulated transcript 1; INAFM2 LINC00984 OGU1

UniProt

P0DMQ5

Expression Region

57-153

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nhlrc2 3'UTR Luciferase Stable Cell Line
TU114073 1.0 mL

Nhlrc2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DPYSL2 ELISA Kit (Mouse) (OKEH05358)
OKEH05358 96 Well

DPYSL2 ELISA Kit (Mouse) (OKEH05358)

Sign In for Pricing
View Details
Sirt4 (NM_001167691) Mouse Untagged Clone
MC211618 10 µg

Sirt4 (NM_001167691) Mouse Untagged Clone

Sign In for Pricing
View Details
Zbtb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7221506 1.0 µg DNA

Zbtb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
FAM154A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0749207 1.0 µg DNA

FAM154A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human RIN2 Protein Lysate 20ug
IHURIN2PLLY20UG 20 µg

Human RIN2 Protein Lysate 20ug

Sign In for Pricing
View Details