Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretoglobin family 1C member 2 (SG1C2)

This Recombinant Human Secretoglobin family 1C member 2 (SG1C2) spans the amino acid sequence from region 24-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretoglobin family 1C member 2 SCGB1C2

UniProt

P0DMR2

Expression Region

24-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCRDGLQPMHKAELVKLLVQVLGSQDGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-(-)-2-Chloropropionic acid
abx182767-01 25 g

(S)-(-)-2-Chloropropionic acid

Sign In for Pricing
View Details
(S)-(-)-2-Chloropropionic acid
abx182767-02 100 g

(S)-(-)-2-Chloropropionic acid

Sign In for Pricing
View Details
Fatty Acid Binding Protein (H-FABP), Recombinant, His-Tag
470719 1 mg

Fatty Acid Binding Protein (H-FABP), Recombinant, His-Tag

Sign In for Pricing
View Details
Rabbit Polyclonal Proteasome 26S S5 Antibody [mFluor Violet 500 SE]
NB120-3319MFV500 0.1 mL

Rabbit Polyclonal Proteasome 26S S5 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Defb42 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV669661 1.0 µg DNA

Defb42 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Afatinib
MBS3604489-01 200 mg

Afatinib

Sign In for Pricing
View Details