Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL)

This Recombinant Human Putative protein T-ENOL (ENOL) spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATE1 Rabbit Polyclonal Antibody (FITC)
orb2595750 100 µg

ATE1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ZNF263 HDR Plasmid (h)
sc-411418-HDR 20 µg

ZNF263 HDR Plasmid (h)

Sign In for Pricing
View Details
SMAD3 Antibody
31-155 100 µL

SMAD3 Antibody

Sign In for Pricing
View Details
MAFF (Transcription Factor MaFF, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog F (Avian)
485257 100 µL

MAFF (Transcription Factor MaFF, V-maf Musculoaponeurotic Fibrosarcoma Oncogene Homolog F (Avian)

Sign In for Pricing
View Details
Recombinant Influenza B virus Non-structural protein 1 (NS)
orb1646852-01 20 µg

Recombinant Influenza B virus Non-structural protein 1 (NS)

Sign In for Pricing
View Details
Recombinant Influenza B virus Non-structural protein 1 (NS)
orb1646852-02 100 µg

Recombinant Influenza B virus Non-structural protein 1 (NS)

Sign In for Pricing
View Details