Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL)

This Recombinant Human Putative protein T-ENOL (ENOL) spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kindlin 2 (FERMT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9E4]
TA500504BM 100 µL

Kindlin 2 (FERMT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9E4]

Sign In for Pricing
View Details
LRBA Human siRNA Oligo Duplex (Locus ID 987)
SR300704 1 Kit

LRBA Human siRNA Oligo Duplex (Locus ID 987)

Sign In for Pricing
View Details
PORCN Protein Lysate (Rat) with C-HA Tag
37237036 100 µg

PORCN Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Bovine Adiponectin Protein (aa 18-240) (Yeast)
VAng-2880Lsx-100g 100 µg

Recombinant Bovine Adiponectin Protein (aa 18-240) (Yeast)

Sign In for Pricing
View Details
Rabbit Polyclonal Epsin 3 Antibody
NBP2-84863-0.1mL 0.1 mL

Rabbit Polyclonal Epsin 3 Antibody

Sign In for Pricing
View Details
CCDC155 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
15221124 3x 1.0µg DNA

CCDC155 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details