Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 225B (T225B), partial

This Recombinant Human Transmembrane protein 225B (T225B), partial spans the amino acid sequence from region 168-221. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 225B TMEM225B

UniProt

P0DP42

Expression Region

168-221

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CLIQEMVCPCWHLLSTSQSMEEDHGSLYLDNLESLGGEPSSVQKETQVTAETVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Synechococcus sp. (strain 27264/PCC 7002/PR-6)(Agmenellum quadruplicatum) PSAE Polyclonal Antibody
MBS7158109 Inquire

Rabbit anti-Synechococcus sp. (strain 27264/PCC 7002/PR-6)(Agmenellum quadruplicatum) PSAE Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Laminin alpha 1 antibody
SL4973R-01 50 µL

Rabbit Anti-Laminin alpha 1 antibody

Sign In for Pricing
View Details
Rabbit Anti-Laminin alpha 1 antibody
SL4973R-02 100 µL

Rabbit Anti-Laminin alpha 1 antibody

Sign In for Pricing
View Details
Cal-590™ AM
20512-AAT 1 mg

Cal-590™ AM

Sign In for Pricing
View Details
Trim22
MBS8578490-01 0.1 mL

Trim22

Sign In for Pricing
View Details
Trim22
MBS8578490-02 0.1 mL (AF405L)

Trim22

Sign In for Pricing
View Details