Recombinant Human Putative uncharacterized protein MED14OS (M14OS)
This Recombinant Human Putative uncharacterized protein MED14OS (M14OS) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative uncharacterized protein MED14OS; MED14 antisense gene protein 1; MED14 opposite strand protein; MED14OS MED14-AS1
UniProt
P0DP75
Expression Region
1-135
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MRSSSLPGARSPRRNGSGQSRHRLPPGRLRTGSRAPTAEARPHVARSPPTPGTGARGGGRRGWGGSRAAPQRGSCASANAQKQLRQTAATYMLTARGGSRSAERKGDLQRTFRQVGQTMPMVPPLDFTMNAASVE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Lsx0528-inquire Inquire
Recombinant VACV O1L Protein (aa 1-666)
Sign In for Pricing
View Details 131988-ML750 100 µL
PSMD9 (26S Proteasome non-ATPase Regulatory Subunit 9, 26S Proteasome Regulatory Subunit p27) (MaxLight 750) discontinued
Sign In for Pricing
View Details