Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51B (CX05B)

This Recombinant Human Uncharacterized protein CXorf51B (CX05B) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51B CXorf51B

UniProt

P0DPH9

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPA Antibody, HRP conjugated
CSB-PA362446YB01HU-01 50 µg

LPA Antibody, HRP conjugated

Sign In for Pricing
View Details
LPA Antibody, HRP conjugated
CSB-PA362446YB01HU-02 100 µg

LPA Antibody, HRP conjugated

Sign In for Pricing
View Details
Phospho-GRK2 (Ser670) Polyclonal Antibody, Cy5 Conjugated
bs-16682R-Cy5 100 µL

Phospho-GRK2 (Ser670) Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
PCMV-C-Myc-Zeo
D2788-1μg 1 μg

PCMV-C-Myc-Zeo

Sign In for Pricing
View Details
Calcium Sensing Receptor Antibody
orb251882-01 50 μL

Calcium Sensing Receptor Antibody

Sign In for Pricing
View Details
Calcium Sensing Receptor Antibody
orb251882-02 100 µL

Calcium Sensing Receptor Antibody

Sign In for Pricing
View Details