Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial

This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative taste receptor type 2 member 33; T2R33; hGR33; TAS2R33

UniProt

P0DSN6

Expression Region

149-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth Arrest Specific Protein 7 (GAS7) Human qPCR Primer Pair (NM_201433)
HP230099 200 Reactions

Growth Arrest Specific Protein 7 (GAS7) Human qPCR Primer Pair (NM_201433)

Sign In for Pricing
View Details
2-Bromo-1-propanol
TRC-B687385-2.5G 2.5 g

2-Bromo-1-propanol

Sign In for Pricing
View Details
DIS3 Rabbit Polyclonal Antibody
TA368185 100 µL

DIS3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary
CP565729 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17647-01 50 μL

TAFA1 Antibody

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17647-02 100 µL

TAFA1 Antibody

Sign In for Pricing
View Details