Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial

This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative taste receptor type 2 member 33; T2R33; hGR33; TAS2R33

UniProt

P0DSN6

Expression Region

149-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-, 1mL 20nm
GP-3101-20 1 mL

Colloidal Gold Conjugated Wisteria floribunda Lectin (Japanese Wisteria) -WFA-, 1mL 20nm

Sign In for Pricing
View Details
Primer Panel
HPP6002C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
VNN3 (NM_018399) Human Over-expression Lysate
LY402675 100 µg

VNN3 (NM_018399) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813D-01 25 µg

PE Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813D-02 100 µg

PE Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
TRIM21 (NM_003141) Human Over-expression Lysate
LC401090 20 µg

TRIM21 (NM_003141) Human Over-expression Lysate

Sign In for Pricing
View Details