Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial

This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative taste receptor type 2 member 33; T2R33; hGR33; TAS2R33

UniProt

P0DSN6

Expression Region

149-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AU1 tag Mouse Monoclonal Antibody [F7-C2]
EM50803 100 µL

AU1 tag Mouse Monoclonal Antibody [F7-C2]

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF405S conjugate, 0.1mg/mL
BNC042210-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLEC12A (NM_201623) Human Over-expression Lysate
LC404485 20 µg

CLEC12A (NM_201623) Human Over-expression Lysate

Sign In for Pricing
View Details
Hexadecafluoroheptane
TRC-H293823-500MG 500 mg

Hexadecafluoroheptane

Sign In for Pricing
View Details
MASP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]
CF812529 100 µg

MASP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

Sign In for Pricing
View Details
LMNA Antibody
KC-6308-01 50 μL

LMNA Antibody

Sign In for Pricing
View Details