Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PTTG1IP family member 2 (PTIP2), partial

This Recombinant Human PTTG1IP family member 2 (PTIP2), partial spans the amino acid sequence from region 27-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTTG1IP family member 2 PTTG1IP2

UniProt

P0DTF9

Expression Region

27-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FSENGFIHSPRNNQKPRDGNEEECAVKKSCQLCTEDKKCVWCSEEKACKKYCFPYFGCRFSSIYWLNCKVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Nitroso Naratriptan pyridinium impurity
CS-O-51754 1 Each

N-Nitroso Naratriptan pyridinium impurity

Sign In for Pricing
View Details
Rabbit Polyclonal KPNA3 Antibody
NBP3-17268-25ul 25 µL

Rabbit Polyclonal KPNA3 Antibody

Sign In for Pricing
View Details
Fibroblast Growth Factor Receptor (FGFR, flg5)
F4305-07-01 50 µg

Fibroblast Growth Factor Receptor (FGFR, flg5)

Sign In for Pricing
View Details
Fibroblast Growth Factor Receptor (FGFR, flg5)
F4305-07-02 250 µg

Fibroblast Growth Factor Receptor (FGFR, flg5)

Sign In for Pricing
View Details
Olfr365 AAV Vector (Mouse) (CMV)
33101104 1 µg

Olfr365 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
CDKN1A Protein Vector (Mouse) (pPM-C-HA)
15725024 500 ng

CDKN1A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details