Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E18 (SPD18)

This Recombinant Human Speedy protein E18 (SPD18) spans the amino acid sequence from region 1-352. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E18 SPDYE18

UniProt

P0DV79

Expression Region

1-352

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRTKTRFRKRGQITGKITTSRQPHPQNEQSLQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSRIPLVRNRRFQLCRCLNPRARKNRSQIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPEHWVWARDRARLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tm2d1 (BC089492) Mouse Tagged ORF Clone
MG202221 10 µg

Tm2d1 (BC089492) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FAM161A (NM_032180) Human Recombinant Protein
TP315140L 1 mg

FAM161A (NM_032180) Human Recombinant Protein

Sign In for Pricing
View Details
Tyrphostin 25
TRC-T925000-5MG 5 mg

Tyrphostin 25

Sign In for Pricing
View Details
IL17F Mouse Monoclonal Antibody [Clone ID: OTI7A2]
TA815386S 30 µL

IL17F Mouse Monoclonal Antibody [Clone ID: OTI7A2]

Sign In for Pricing
View Details
HSP90AA1 / HSP90 alpha Rabbit Polyclonal Antibody
AP06175PU-N 100 µg

HSP90AA1 / HSP90 alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Reg3g Rabbit Polyclonal Antibody
TA380838 100 µL

Reg3g Rabbit Polyclonal Antibody

Sign In for Pricing
View Details