Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Lamin A + Lamin C (S22) Recombinant Rabbit monoclonal Antibody
HA723339 100 µL

Phospho-Lamin A + Lamin C (S22) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
C6orf114 (NM_033069) Human Over-expression Lysate
LY403223 100 µg

C6orf114 (NM_033069) Human Over-expression Lysate

Sign In for Pricing
View Details
Chrdl2 Mouse Gene Knockout Kit (CRISPR)
KN503297 1 Kit

Chrdl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHID1 (NM_001142675) Human Over-expression Lysate
LC428239 20 µg

CHID1 (NM_001142675) Human Over-expression Lysate

Sign In for Pricing
View Details
AK3L1 (AK4) Rabbit Monoclonal Antibody [Clone ID: R08-2B2]
TA421713 100 µL

AK3L1 (AK4) Rabbit Monoclonal Antibody [Clone ID: R08-2B2]

Sign In for Pricing
View Details
RON (MST1R) Human Gene Knockout Kit (CRISPR)
KN212786BN 1 Kit

RON (MST1R) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details