Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM171A1 activation kit by CRISPRa
GA116588 1 Kit

Human FAM171A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Ddt (NM_010027) Mouse Tagged ORF Clone
MG200552 10 µg

Ddt (NM_010027) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
-40°C Upright Freezer BFUR-40-309
BFUR-40-309 1 Unit

-40°C Upright Freezer BFUR-40-309

Sign In for Pricing
View Details
IRAG2 Antibody
KC-1187-01 50 μL

IRAG2 Antibody

Sign In for Pricing
View Details
IRAG2 Antibody
KC-1187-02 100 µL

IRAG2 Antibody

Sign In for Pricing
View Details
IRAG2 Antibody
KC-1187-03 1 mL

IRAG2 Antibody

Sign In for Pricing
View Details