Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSF Antibody
KC-35413-01 50 μL

NSF Antibody

Sign In for Pricing
View Details
NSF Antibody
KC-35413-02 100 µL

NSF Antibody

Sign In for Pricing
View Details
NSF Antibody
KC-35413-03 1 mL

NSF Antibody

Sign In for Pricing
View Details
Precision Balance BBAL-204
BBAL-204 1 Unit

Precision Balance BBAL-204

Sign In for Pricing
View Details
Plasma/Serum RNA/DNA Purification Mini Kit
55200 50 Preparations

Plasma/Serum RNA/DNA Purification Mini Kit

Sign In for Pricing
View Details
CD163 Antibody
KC-2753-01 50 μL

CD163 Antibody

Sign In for Pricing
View Details