Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-15C (TB15C)

This Recombinant Human Thymosin beta-15C (TB15C) spans the amino acid sequence from region 2-45. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymosin beta-15C TMSB15C

UniProt

P0DX04

Expression Region

2-45

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpastatin (CAST/1550), CF640R conjugate, 0.1mg/mL
BNC401550-500 1x 500 µL

Calpastatin (CAST/1550), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Antithrombin III (SERPINC1) (NM_000488) Human Over-expression Lysate
LC400166 20 µg

Antithrombin III (SERPINC1) (NM_000488) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPP) (N-term) Rabbit Polyclonal Antibody
AP50155PU-N 400 µL

Alkaline Phosphatase (ALPP) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD28 Mouse Monoclonal Antibody [Clone ID: CD28.2]
AM12006PU-N 100 µg

CD28 Mouse Monoclonal Antibody [Clone ID: CD28.2]

Sign In for Pricing
View Details
FUT3 (NM_001097639) Human Over-expression Lysate
LY420413 100 µg

FUT3 (NM_001097639) Human Over-expression Lysate

Sign In for Pricing
View Details
RPL12 (NM_000976) Human Over-expression Lysate
LC424422 20 µg

RPL12 (NM_000976) Human Over-expression Lysate

Sign In for Pricing
View Details