Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative chemokine-related protein B42 (CCB42)

This Recombinant Human Putative chemokine-related protein B42 (CCB42) spans the amino acid sequence from region 1-81. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative chemokine-related protein B42

UniProt

Q1T7F1

Expression Region

1-81

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPLSDWCCGICEEAPLGRAYTQTWMETGCGPHGVTALGQQELKDCLRARSGGTASSVDWIMEAARGSLNVHNCLIKFGRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-sulfobutyl) -3-methylimidazolium bis (trifluoromethylsulfonyl) imide
IL-0354-HP-0500 500 g

1- (4-sulfobutyl) -3-methylimidazolium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
ATP-sensitive inward rectifier potassium channel 1 (KCNJ1) Rat ELISA Kit
B7433 96 Tests

ATP-sensitive inward rectifier potassium channel 1 (KCNJ1) Rat ELISA Kit

Sign In for Pricing
View Details
Plakophilin 3 Rabbit pAb, AE conjugated
orb2883700 100 µL

Plakophilin 3 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Gm438 (NM_001126316) Mouse Tagged ORF Clone
MR213135 10 µg

Gm438 (NM_001126316) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Pseudomonas stutzeri Membrane protein nosY
MBS1046772 Inquire

Recombinant Pseudomonas stutzeri Membrane protein nosY

Sign In for Pricing
View Details
Selenocysteine Lyase (SCLY, SCL, hSCL) (HRP)
MBS6393358-01 0.1 mL

Selenocysteine Lyase (SCLY, SCL, hSCL) (HRP)

Sign In for Pricing
View Details