Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Streptococcus Pneumoniae rnhB Protein (aa 1-259) (strain JJA)
VAng-Cr7906-500gEcoli 500 µg (E. coli)

Recombinant Streptococcus Pneumoniae rnhB Protein (aa 1-259) (strain JJA)

Sign In for Pricing
View Details
TRIM63, Control Peptide (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ FLJ32380)
148201 100 µg

TRIM63, Control Peptide (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ FLJ32380)

Sign In for Pricing
View Details
Hsd3b5 (NM_012584) Rat Untagged Clone
RN211717 10 µg

Hsd3b5 (NM_012584) Rat Untagged Clone

Sign In for Pricing
View Details
NAT-2 (m) : 293T Lysate
sc-121945 100 µg - 200 µL

NAT-2 (m) : 293T Lysate

Sign In for Pricing
View Details
FAM35B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0721308 1.0 µg DNA

FAM35B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human iPSC-Derived Skeletal Muscle Myoblasts
CSC-00832L One Frozen Vial

Human iPSC-Derived Skeletal Muscle Myoblasts

Sign In for Pricing
View Details