Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM132B (NM_052907) Human Over-expression Lysate
E45H13288-2 20 µg

TMEM132B (NM_052907) Human Over-expression Lysate

Sign In for Pricing
View Details
Actin, Cytoplasmic 1 (ACTB) ELISA Kit
abx156758-01 96 Tests

Actin, Cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Actin, Cytoplasmic 1 (ACTB) ELISA Kit
abx156758-02 5x 96 Tests

Actin, Cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
Actin, Cytoplasmic 1 (ACTB) ELISA Kit
abx156758-03 10x 96 Tests

Actin, Cytoplasmic 1 (ACTB) ELISA Kit

Sign In for Pricing
View Details
5-Chloro-6- (methylsulfonyl) nicotinic acid
OR1047776-01 100 mg

5-Chloro-6- (methylsulfonyl) nicotinic acid

Sign In for Pricing
View Details
5-Chloro-6- (methylsulfonyl) nicotinic acid
OR1047776-02 250 mg

5-Chloro-6- (methylsulfonyl) nicotinic acid

Sign In for Pricing
View Details