Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Semi-micro balance 60mg 0.01g
BAL1162 1 Each

Semi-micro balance 60mg 0.01g

Sign In for Pricing
View Details
HOXB4 Polyclonal Antibody, PerCP Conjugated
bs-3650R-PerCP-TR 20 µL

HOXB4 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
FBXW10 Antibody (Biotin)
orb354916-01 50 µg

FBXW10 Antibody (Biotin)

Sign In for Pricing
View Details
FBXW10 Antibody (Biotin)
orb354916-02 100 µg

FBXW10 Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter sp. V-type ATP synthase subunit D (atpD)
MBS1161026-01 0.02 mg (E-Coli)

Recombinant Thermoanaerobacter sp. V-type ATP synthase subunit D (atpD)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter sp. V-type ATP synthase subunit D (atpD)
MBS1161026-02 0.1 mg (E-Coli)

Recombinant Thermoanaerobacter sp. V-type ATP synthase subunit D (atpD)

Sign In for Pricing
View Details