Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Torsin-1A-interacting protein 2, isoform IFRG15 (IFG15)

This Recombinant Human Torsin-1A-interacting protein 2, isoform IFRG15 (IFG15) spans the amino acid sequence from region 1-131. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Torsin-1A-interacting protein 2, isoform IFRG15; 15 kDa interferon-responsive protein; IFRG15; TOR1AIP2 IFRG15

UniProt

Q9H496

Expression Region

1-131

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPLEWAPQNLTRWTFEKACHPFLLGPPLVRKRIHDSRVAGFNPALQLILTRTDKTLNKKLGQNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium (3-chloro-4-fluorophenyl) trifluoroborate
sc-264094A 5 g

Potassium (3-chloro-4-fluorophenyl) trifluoroborate

Sign In for Pricing
View Details
PSO Antibody
E38PA5507 100 µL

PSO Antibody

Sign In for Pricing
View Details
Stromal Cell-Derived Factor 1alpha 15µg
30141647 5 µg

Stromal Cell-Derived Factor 1alpha 15µg

Sign In for Pricing
View Details
BAYK 8644
531565 50.0mg

BAYK 8644

Sign In for Pricing
View Details
Hsa-miR-4727-3p miRNA Inhibitor
CIH1581-01 10 nmol

Hsa-miR-4727-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-4727-3p miRNA Inhibitor
CIH1581-02 20 nmol

Hsa-miR-4727-3p miRNA Inhibitor

Sign In for Pricing
View Details