Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Translation machinery-associated protein 7B (TMA7B)

This Recombinant Human Translation machinery-associated protein 7B (TMA7B) spans the amino acid sequence from region 1-64. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Translation machinery-associated protein 7B TMA7B

UniProt

A0A024R1R8

Expression Region

1-64

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-500 1x 500 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF640R conjugate, 0.1mg/mL
BNC400880-500 1x 500 µL

P57 / KIP2 (KIP2/880), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF594 conjugate, 0.1mg/mL
BNC940183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details